PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca6453.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family FAR1
Protein Properties Length: 1003aa    MW: 114204 Da    PI: 8.478
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca6453.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR127.21.3e-08108157151
       FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkkteke 51 
                +fYn+YA+++GF++rk+ +k++ ++g    +t+vC+k+g+ + +  +++ +
  Dca6453.1 108 EFYNSYATTCGFTMRKEGEKRN-EKGLPSYKTLVCNKHGEGKAKGAANSPK 157
                6****************99998.777799***********99988772222 PP

2FAR153.39.4e-17190273190
       FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                +fY++YA+++GF++rk+ +k++ ++g    +t vC+k+g+ + + +      ++r++tr gCka++  k+ ++g+++v+k+++ HnH+++
  Dca6453.1 190 QFYSSYATTCGFTMRKEGEKRN-EKGLPSYKTCVCNKHGQGKATGRI-----KKREVTRQGCKACVSFKMVENGEYMVYKFVEAHNHHMM 273
                6****************99998.7777999**********9998766.....99*********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.1E-5108157IPR004330FAR1 DNA binding domain
PfamPF031018.0E-13190273IPR004330FAR1 DNA binding domain
PfamPF105514.9E-26395488IPR018289MULE transposase domain
Sequence ? help Back to Top
Protein Sequence    Length: 1003 aa     Download sequence    Send to blast
MESTVEDPSG TIVPSTSIQD TMMRDVSNTE TESTNAMETT DCVGSCSANE KDTTQKEADS  60
PTVTFQNQSA ANSPESTATK SCDGVPYCRD ELKPLVGKKF ASLEQGIEFY NSYATTCGFT  120
MRKEGEKRNE KGLPSYKTLV CNKHGEGKAK GAANSPKSTA TKSCDGVPYC RDELKPLVGK  180
KFASLQQAIQ FYSSYATTCG FTMRKEGEKR NEKGLPSYKT CVCNKHGQGK ATGRIKKREV  240
TRQGCKACVS FKMVENGEYM VYKFVEAHNH HMMTPTTMVH LKSGRELNVV HKKMIIDNSR  300
VNHGPVKTFR MFKEYVKGYN NIGASLQDFK NFSRDVKKYL KEYDAQMMIE TFIQKRAMCP  360
SFYFDFDVDE DQKLTKLFWA DPISIKNYAL YGDSCSFDTT FDFNKYKMVF APFTGVDNHK  420
KCVTFGAGLI SKEDADSFSW LFENFLKAVG GCYPTTLITD QCLGIKAGVD KVFSDKTHHR  480
YCMWHITKKM PEKVGASVSR DTDFLKEISA IIWGDEVEIE EFEAEWKNIV EKYDLSDNEW  540
LSQIFDMRKS WIPSYFRDTY LGGLLRTTSR SESENSFFSN FTNPQLSLVE FYMRFQSAMD  600
AQRWKNSKLT ADSKNSSPVI TTPLLMEKQA SEFYTPALFY EFQEELTACC FNCGLHSMRT  660
DENVEMITVN DRQRKKLYEV AYHENEISCS CKRFERFGML FGELWSELFT SVSLVENDEE  720
KTEELLALLQ SFNEQLLLDS KKKAKGKGKK AEIETLIGSK IPVEAHVLPP NIAKNKGSGK  780
RMMTDREKAT QEHQKPLRKC RACGEMANHD SRNCDKSPQS KKKKRHALWV LKDRGFQEIP  840
SEYMLSRWSK IAMCRPIFNV VGTTLLEDCA SVDTRQQKVG ELWSELFTSV SLVENDEEKT  900
EELLALLQSF NEQLLLNSKK KAKGKGKQAE IETLIGSKIP VEAHVLPPNI AKNKGSGKRM  960
MTDKEKATQE HQKPLRKCRA CGEMANHDSR NCDKSRQSKK KKR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1744750KGKGKKA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-84FAR1-related sequence 5